Lineage for d6s29a_ (6s29 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2808917Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2809156Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2809157Protein automated matches [190568] (10 species)
    not a true protein
  7. 2809199Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [372781] (2 PDB entries)
  8. 2809201Domain d6s29a_: 6s29 A: [372785]
    automated match to d4xyha_
    complexed with br

Details for d6s29a_

PDB Entry: 6s29 (more details), 1.99 Å

PDB Description: structure of fission yeast mis16-mis19 complex
PDB Compounds: (A:) Histone acetyltransferase type B subunit 2

SCOPe Domain Sequences for d6s29a_:

Sequence, based on SEQRES records: (download)

>d6s29a_ b.69.4.0 (A:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
elnaeidlqktiqeeyklwkqnvpflydlvithalewpsltiqwlpdkktipgtdysiqr
lilgthtsgndqnylqiasvqlpnfdedtteftpstirraqatgsytieisqkiphdgdv
nrarympqkpeiiatmgeggnayifdttchdalttgealpqavlkghtaegfglcwnpnl
pgnlatgaedqviclwdvqtqsftssetkvispiakyhrhtdivndvqfhpqheallasv
sddctlqihdtrlnpeeeapkviqahskainavainpfndyllatasadktvalwdlrnp
yqrlhtleghedevyglewsphdepilassstdrrvciwdlekigeeqtpedaedgspel
lfmhgghtnrisefswcpnerwvvgsladdnilqiwspsrviwg

Sequence, based on observed residues (ATOM records): (download)

>d6s29a_ b.69.4.0 (A:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
elnaeidlqktiqeeyklwkqnvpflydlvithalewpsltiqwlpdkktipgtdysiqr
lilgthtsgndqnylqiasvqlpnfdedtteftpstirraqatgsytieisqkiphdgdv
nrarympqkpeiiatmgeggnayifdttpqavlkghtaegfglcwnpnlpgnlatgaedq
viclwdvqtqsftssetkvispiakyhrhtdivndvqfhpqheallasvsddctlqihdt
rlnpeeeapkviqahskainavainpfndyllatasadktvalwdlrnpyqrlhtleghe
devyglewsphdepilassstdrrvciwdlekigeeqtpedaedgspellfmhgghtnri
sefswcpnerwvvgsladdnilqiwspsrviwg

SCOPe Domain Coordinates for d6s29a_:

Click to download the PDB-style file with coordinates for d6s29a_.
(The format of our PDB-style files is described here.)

Timeline for d6s29a_: