SCOPe 2.07: Domain d1onca1: 1onc A:2-104

Lineage for d1onca1 (1onc A:2-104)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Amphibian cytotoxic ribonuclease [54084] (5 species)

7. Species Frog (Rana pipiens), P-30 [TaxId:8404] [54083] (10 PDB entries)

8. Domain d1onca1: 1onc A:2-104 [37278]
   Other proteins in same PDB: d1onca2
   complexed with so4

Details for d1onca1

PDB Entry: 1onc, 1.7 Å

PDB Description: the refined 1.7 angstroms x-ray crystallographic structure of p-30, an amphibian ribonuclease with anti-tumor activity

PDB Compounds: (A:) P-30 protein

SCOPe Domain Sequences for d1onca1:

Sequence; same for both SEQRES and ATOM records:

>d1onca1 d.5.1.1 (A:2-104) Amphibian cytotoxic ribonuclease {Frog (Rana pipiens), P-30 [TaxId: 8404]}
dwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltts
efylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc

Timeline for d1onca1:

• d1onca1 first appeared (with stable ids) in SCOP 1.55, called d1onc__
  
• d1onca1 appears in SCOPe 2.06
  
• d1onca1 appears in the current release, SCOPe 2.08