SCOPe 2.03: Domain d1onca_: 1onc A:

Lineage for d1onca_ (1onc A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Amphibian cytotoxic ribonuclease [54084] (5 species)

7. Species Frog (Rana pipiens), P-30 [TaxId:8404] [54083] (10 PDB entries)

8. Domain d1onca_: 1onc A: [37278]
   complexed with so4

Details for d1onca_

PDB Entry: 1onc, 1.7 Å

PDB Description: the refined 1.7 angstroms x-ray crystallographic structure of p-30, an amphibian ribonuclease with anti-tumor activity

PDB Compounds: (A:) P-30 protein

SCOPe Domain Sequences for d1onca_:

Sequence; same for both SEQRES and ATOM records:

>d1onca_ d.5.1.1 (A:) Amphibian cytotoxic ribonuclease {Frog (Rana pipiens), P-30 [TaxId: 8404]}
edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
sefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc

Timeline for d1onca_:

• d1onca_ first appeared (with stable ids) in SCOP 1.55, called d1onc__
  
• d1onca_ appears in SCOPe 2.02
  
• d1onca_ appears in SCOPe 2.04
  
• d1onca_ appears in the current release, SCOPe 2.08, called d1onca1