SCOP 1.61: Domain d1onc__: 1onc -

Lineage for d1onc__ (1onc -)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)

4. Superfamily d.5.1: RNase A-like [54076] (1 family)

5. Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)

6. Protein Amphibian cytotoxic ribonuclease [54084] (3 species)

7. Species Frog (Rana pipiens), P-30 [TaxId:8404] [54083] (1 PDB entry)

8. Domain d1onc__: 1onc - [37278]

Details for d1onc__

PDB Entry: 1onc, 1.7 Å

PDB Description: the refined 1.7 angstroms x-ray crystallographic structure of p-30, an amphibian ribonuclease with anti-tumor activity

SCOP Domain Sequences for d1onc__:

Sequence; same for both SEQRES and ATOM records:

>d1onc__ d.5.1.1 (-) Amphibian cytotoxic ribonuclease {Frog (Rana pipiens), P-30}
edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
sefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc

Timeline for d1onc__:

• d1onc__ first appeared (with stable ids) in SCOP 1.55
  
• d1onc__ appears in SCOP 1.59
  
• d1onc__ appears in SCOP 1.63
  
• d1onc__ appears in the current release, SCOPe 2.08, called d1onca1