Lineage for d1onc__ (1onc -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77162Fold d.5: RNase A-like [54075] (1 superfamily)
  4. 77163Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
  5. 77164Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 77199Protein P-30 protein [54082] (1 species)
  7. 77200Species Frog (Rana pipiens) [TaxId:8404] [54083] (1 PDB entry)
  8. 77201Domain d1onc__: 1onc - [37278]

Details for d1onc__

PDB Entry: 1onc (more details), 1.7 Å

PDB Description: the refined 1.7 angstroms x-ray crystallographic structure of p-30, an amphibian ribonuclease with anti-tumor activity

SCOP Domain Sequences for d1onc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1onc__ d.5.1.1 (-) P-30 protein {Frog (Rana pipiens)}
edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
sefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc

SCOP Domain Coordinates for d1onc__:

Click to download the PDB-style file with coordinates for d1onc__.
(The format of our PDB-style files is described here.)

Timeline for d1onc__: