Lineage for d1onc__ (1onc -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) Fold d.5: RNase A-like [54075] (1 superfamily) Superfamily d.5.1: RNase A-like [54076] (1 family) 
Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins) 
Protein P-30 protein [54082] (1 species) Species Frog (Rana pipiens) [TaxId:8404] [54083] (1 PDB entry) 
Domain d1onc__: 1onc - [37278]
Details for d1onc__
PDB Entry: 1onc (more details), 1.7 Å
PDB Description: the refined 1.7 angstroms x-ray crystallographic structure of p-30, an amphibian ribonuclease with anti-tumor activity
SCOP Domain Sequences for d1onc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1onc__ d.5.1.1 (-) P-30 protein {Frog (Rana pipiens)}
edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
sefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc
SCOP Domain Coordinates for d1onc__:
Click to download the PDB-style file with coordinates for d1onc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1onc__:
- d1onc__ appears in SCOP 1.57
- d1onc__ appears in the current release, SCOPe 2.08, called d1onca1
View in 3D