![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.5: RNase A-like [54075] (1 superfamily) |
![]() | Superfamily d.5.1: RNase A-like [54076] (1 family) ![]() |
![]() | Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins) |
![]() | Protein P-30 protein [54082] (1 species) |
![]() | Species Frog (Rana pipiens) [TaxId:8404] [54083] (1 PDB entry) |
![]() | Domain d1onc__: 1onc - [37278] |
PDB Entry: 1onc (more details), 1.7 Å
SCOP Domain Sequences for d1onc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1onc__ d.5.1.1 (-) P-30 protein {Frog (Rana pipiens)} edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt sefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc
Timeline for d1onc__: