Lineage for d1rraa_ (1rra A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 324599Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 324600Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
    can be classified as disulphide-rich
  5. 324601Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 324661Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 324810Species Rat (Rattus norvegicus) [TaxId:10116] [54081] (1 PDB entry)
  8. 324811Domain d1rraa_: 1rra A: [37277]
    complexed with po4; mutant

Details for d1rraa_

PDB Entry: 1rra (more details), 2.5 Å

PDB Description: ribonuclease a from rattus norvegicus (common rat)

SCOP Domain Sequences for d1rraa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rraa_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Rat (Rattus norvegicus)}
aessadkfkrqhmdtegpskssptycnqmmkrqgmtkgsckpvntfvhepledvqaicsq
gqvtckngrnnchkssstlritdcrlkgsskypncdytttdsqkhiiiacdgnpyvpvhf
dasv

SCOP Domain Coordinates for d1rraa_:

Click to download the PDB-style file with coordinates for d1rraa_.
(The format of our PDB-style files is described here.)

Timeline for d1rraa_: