SCOPe 2.07: Domain d1dzab_: 1dza B:

Lineage for d1dzab_ (1dza B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species)

7. Species Human (Homo sapiens), des1-7 [TaxId:9606] [54080] (8 PDB entries)

8. Domain d1dzab_: 1dza B: [37276]
   designed cytotoxic mutant

Details for d1dzab_

PDB Entry: 1dza, 1.65 Å

PDB Description: 3-d structure of a hp-rnase

PDB Compounds: (B:) ribonuclease 1

SCOPe Domain Sequences for d1dzab_:

Sequence, based on SEQRES records:

>d1dzab_ d.5.1.1 (B:) Ribonuclease A (also ribonuclease B, S) {Human (Homo sapiens), des1-7 [TaxId: 9606]}
esaaakferqhmdsgnspsssstycnqmmrrrnmtqgrckpvntfvheslvdvqnvcfqe
kvtckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvhfd
asved

Sequence, based on observed residues (ATOM records):

>d1dzab_ d.5.1.1 (B:) Ribonuclease A (also ribonuclease B, S) {Human (Homo sapiens), des1-7 [TaxId: 9606]}
esaaakferqhmdsgnsstycnqmmrrrnmtqgrckpvntfvheslvdvqnvcfqekvtc
kngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvhfdasve
d

Timeline for d1dzab_:

• d1dzab_ first appeared (with stable ids) in SCOP 1.55
  
• d1dzab_ appears in SCOPe 2.06
  
• d1dzab_ appears in the current release, SCOPe 2.08