Lineage for d1dzab_ (1dza B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 29802Fold d.5: RNase A-like [54075] (1 superfamily)
  4. 29803Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
  5. 29804Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 29839Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 29953Species Human (Homo sapiens) [TaxId:9606] [54080] (1 PDB entry)
  8. 29955Domain d1dzab_: 1dza B: [37276]

Details for d1dzab_

PDB Entry: 1dza (more details), 1.65 Å

PDB Description: 3-d structure of a hp-rnase

SCOP Domain Sequences for d1dzab_:

Sequence, based on SEQRES records: (download)

>d1dzab_ d.5.1.1 (B:) Ribonuclease A (also ribonuclease B, S) {Human (Homo sapiens)}
esaaakferqhmdsgnspsssstycnqmmrrrnmtqgrckpvntfvheslvdvqnvcfqe
kvtckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvhfd
asved

Sequence, based on observed residues (ATOM records): (download)

>d1dzab_ d.5.1.1 (B:) Ribonuclease A (also ribonuclease B, S) {Human (Homo sapiens)}
esaaakferqhmdsgnsstycnqmmrrrnmtqgrckpvntfvheslvdvqnvcfqekvtc
kngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvhfdasve
d

SCOP Domain Coordinates for d1dzab_:

Click to download the PDB-style file with coordinates for d1dzab_.
(The format of our PDB-style files is described here.)

Timeline for d1dzab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dzaa_