Lineage for d1dzaa_ (1dza A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 188484Fold d.5: RNase A-like [54075] (1 superfamily)
  4. 188485Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
  5. 188486Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 188538Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 188680Species Human (Homo sapiens), des1-7 [TaxId:9606] [54080] (2 PDB entries)
  8. 188682Domain d1dzaa_: 1dza A: [37275]

Details for d1dzaa_

PDB Entry: 1dza (more details), 1.65 Å

PDB Description: 3-d structure of a hp-rnase

SCOP Domain Sequences for d1dzaa_:

Sequence, based on SEQRES records: (download)

>d1dzaa_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Human (Homo sapiens), des1-7}
mkesaaakferqhmdsgnspsssstycnqmmrrrnmtqgrckpvntfvheslvdvqnvcf
qekvtckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvh
fdasve

Sequence, based on observed residues (ATOM records): (download)

>d1dzaa_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Human (Homo sapiens), des1-7}
mkesaaakferqhmdsgnstycnqmmrrrnmtqgrckpvntfvheslvdvqnvcfqekvt
ckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvhfdasv
e

SCOP Domain Coordinates for d1dzaa_:

Click to download the PDB-style file with coordinates for d1dzaa_.
(The format of our PDB-style files is described here.)

Timeline for d1dzaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dzab_