Lineage for d2aas__ (2aas -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 29802Fold d.5: RNase A-like [54075] (1 superfamily)
  4. 29803Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
  5. 29804Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 29839Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 29840Species Cow (Bos taurus) [TaxId:9913] [54079] (93 PDB entries)
  8. 29952Domain d2aas__: 2aas - [37274]

Details for d2aas__

PDB Entry: 2aas (more details)

PDB Description: high-resolution three-dimensional structure of ribonuclease a in solution by nuclear magnetic resonance spectroscopy

SCOP Domain Sequences for d2aas__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aas__ d.5.1.1 (-) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOP Domain Coordinates for d2aas__:

Click to download the PDB-style file with coordinates for d2aas__.
(The format of our PDB-style files is described here.)

Timeline for d2aas__: