SCOPe 2.08: Domain d6p54a1: 6p54 A:237-574

Lineage for d6p54a1 (6p54 A:237-574)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Neisseria gonorrhoeae [TaxId:485] [225541] (16 PDB entries)

8. Domain d6p54a1: 6p54 A:237-574 [372731]
   Other proteins in same PDB: d6p54a2, d6p54b2
   automated match to d5uy7a_
   complexed with 9f2, cef, nzv, peg

Details for d6p54a1

PDB Entry: 6p54, 1.83 Å

PDB Description: crystal structure of transpeptidase domain of pbp2 from neisseria gonorrhoeae acylated by ceftriaxone

PDB Compounds: (A:) Probable peptidoglycan D,D-transpeptidase PenA

SCOPe Domain Sequences for d6p54a1:

Sequence; same for both SEQRES and ATOM records:

>d6p54a1 e.3.1.0 (A:237-574) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
lsldqriqtlayeelnkaveyhqakagtvvvldartgeilalantpgrnravtdmiepgs
aikpfviakaldagktdlnerlntqpykigpspvrdthvypsldvrgimqkssnvgtskl
sarfgaeemydfyhelgigvrmhsgfpgetagllrnwrrwrpieqatmsfgyglqlsllq
laraytalthdgvllplsfekqavapqgkrifkestarevrnlmvsvtepggtgtagavd
gfdvgaktgtarkfvngryadnkhvatfigfapaknprvivavtideptahgyyggvvag
ppfkkimggslnilgisptkplta

Timeline for d6p54a1:

• d6p54a1 first appeared in SCOPe 2.07