Lineage for d1bzqd_ (1bzq D:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 29802Fold d.5: RNase A-like [54075] (1 superfamily)
  4. 29803Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
  5. 29804Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 29839Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 29840Species Cow (Bos taurus) [TaxId:9913] [54079] (93 PDB entries)
  8. 29951Domain d1bzqd_: 1bzq D: [37273]
    Other proteins in same PDB: d1bzqk_, d1bzql_, d1bzqm_, d1bzqn_

Details for d1bzqd_

PDB Entry: 1bzq (more details), 2.8 Å

PDB Description: complex of a dromedary single-domain vhh antibody fragment with rnase a

SCOP Domain Sequences for d1bzqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bzqd_ d.5.1.1 (D:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOP Domain Coordinates for d1bzqd_:

Click to download the PDB-style file with coordinates for d1bzqd_.
(The format of our PDB-style files is described here.)

Timeline for d1bzqd_: