Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [54079] (188 PDB entries) |
Domain d1bzqc_: 1bzq C: [37272] Other proteins in same PDB: d1bzqk_, d1bzql_, d1bzqm_, d1bzqn_ protein/RNA complex; complexed with po4 |
PDB Entry: 1bzq (more details), 2.8 Å
SCOPe Domain Sequences for d1bzqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bzqc_ d.5.1.1 (C:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]} ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf dasv
Timeline for d1bzqc_: