Lineage for d6nyoa_ (6nyo A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2507728Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2507729Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2508149Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 2508150Protein automated matches [190120] (9 species)
    not a true protein
  7. 2508155Species Human (Homo sapiens) [TaxId:9606] [186843] (27 PDB entries)
  8. 3072651Domain d6nyoa_: 6nyo A: [372713]
    Other proteins in same PDB: d6nyoe1, d6nyoe2
    automated match to d4mdka_
    complexed with edo, po4, u94

Details for d6nyoa_

PDB Entry: 6nyo (more details), 1.5 Å

PDB Description: crystal structure of a human cdc34-ubiquitin thioester mimetic
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 R2

SCOPe Domain Sequences for d6nyoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nyoa_ d.20.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qmtssqkalmlelkslqeepvegfritlvdesdlynwevaifgppntlyeggyfkahikf
pidypyspptfrfltkmwhpniyengdvkisilhppvddpqsgelpserwnptqnvrtil
lsvisllnepntfspanvdasvmfrkwrdskgkdkeyaeiirkqvsatkaeaekdgvkvp
ttlaeyci

SCOPe Domain Coordinates for d6nyoa_:

Click to download the PDB-style file with coordinates for d6nyoa_.
(The format of our PDB-style files is described here.)

Timeline for d6nyoa_:

  • d6nyoa_ is new in SCOPe 2.07-stable