Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
Protein automated matches [190988] (51 species) not a true protein |
Species Murine norovirus 1 [TaxId:223997] [372678] (13 PDB entries) |
Domain d6p4ka_: 6p4k A: [372702] automated match to d1ihmb_ complexed with tch |
PDB Entry: 6p4k (more details), 3.1 Å
SCOPe Domain Sequences for d6p4ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6p4ka_ b.121.4.0 (A:) automated matches {Murine norovirus 1 [TaxId: 223997]} qdlvpaaveqavpiqpvagaalaapaagqinqidpwifqnfvqcplgefsisprntpgei lfdlalgpglnpylahlsamytgwvgnmevqlvlagnaftagkvvvalvppyfpkgsltt aqitcfphvmcdvrtlepiqlplldvrrvlwhatqdqeesmrlvcmlytplrtnspgdes fvvsgrllskpaadfnfvyltppiertiyrmvdlpviqprlctharwpapvygllvdpsl psnpqwqngrvhvdgtllgttpisgswvscfaaeaayefqsgtgevatftlieqdgsayv pgdraaplgypdfsgqleievqtettktgdklkvttfemilgpttnadqapyqgrvfasv taaasldlvdgrvravprsiygfqdtipeyndgllvplappigpflpgevllrfrtymrq idtadaaaeaidcalpqefvswfasnaftvqsealllryrntltgqllfecklynegyia lsysgsgpltfptdgifevvswvprlyqlasvgs
Timeline for d6p4ka_: