SCOPe 2.07: Domain d6p90a_: 6p90 A:

Lineage for d6p90a_ (6p90 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (28 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [372682] (1 PDB entry)

8. Domain d6p90a_: 6p90 A: [372683]
   automated match to d3s8ha_
   complexed with cl, gol; mutant

Details for d6p90a_

PDB Entry: 6p90, 1.9 Å

PDB Description: crystal structure of padhdps2-h56q mutant

PDB Compounds: (A:) 4-hydroxy-tetrahydrodipicolinate synthase

SCOPe Domain Sequences for d6p90a_:

Sequence; same for both SEQRES and ATOM records:

>d6p90a_ c.1.10.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
miagsmvalvtpfdaqgrldwdslaklvdfhlqegtnaivavgttgesatldveeqiqvi
rrvvdqvkgripviagtganstreavalteaaksggadacllvtpyynkptqegmyqhfr
hiaeavaipqilynvpgrtscdmlpetverlskvpniigikeatgdlqrakeviervgkd
flvysgddatavelmllggkgnisvtanvapramsdlcaaamrgdaaaaraindrlmplh
kalfiesnpipvkwalhemglipegirlpltwlsprcheplrqamrqtgvl

Timeline for d6p90a_:

• d6p90a_ is new in SCOPe 2.07-stable
  
• d6p90a_ appears in the current release, SCOPe 2.08