SCOP 1.61: Domain d1rbba_: 1rbb A:

Lineage for d1rbba_ (1rbb A:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)

4. Superfamily d.5.1: RNase A-like [54076] (1 family)

5. Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (115 PDB entries)

8. Domain d1rbba_: 1rbb A: [37268]

Details for d1rbba_

PDB Entry: 1rbb, 2.5 Å

PDB Description: the crystal structure of ribonuclease b at 2.5-angstroms resolution

SCOP Domain Sequences for d1rbba_:

Sequence; same for both SEQRES and ATOM records:

>d1rbba_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d1rbba_:

• d1rbba_ first appeared (with stable ids) in SCOP 1.55
  
• d1rbba_ appears in SCOP 1.59
  
• d1rbba_ appears in SCOP 1.63
  
• d1rbba_ appears in the current release, SCOPe 2.08