Lineage for d6nyaf_ (6nya F:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2507728Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2507729Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2508149Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 2508150Protein automated matches [190120] (9 species)
    not a true protein
  7. 2508155Species Human (Homo sapiens) [TaxId:9606] [186843] (27 PDB entries)
  8. 3072606Domain d6nyaf_: 6nya F: [372668]
    Other proteins in same PDB: d6nyab1, d6nyab2, d6nyae1, d6nyae2
    automated match to d3fn1b_
    complexed with atp, edo, mg, so4

Details for d6nyaf_

PDB Entry: 6nya (more details), 2.07 Å

PDB Description: crystal structure of ubiquitin e1 (uba1) in complex with ubc3 (cdc34) and ubiquitin
PDB Compounds: (F:) Ubiquitin-conjugating enzyme E2-34 kDa

SCOPe Domain Sequences for d6nyaf_:

Sequence, based on SEQRES records: (download)

>d6nyaf_ d.20.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kstasslllrqyreltdpkkaipsfhieleddsniftwnigvmvlnedsiyhggffkaqm
rfpedfpfsppqfrftpaiyhpnvyrdgrlcisilhqsgdpmtdepdaetwspvqtvesv
lisivslledpninspanvdaavdyrknpeqykqrvkmeverskqdipkgfimp

Sequence, based on observed residues (ATOM records): (download)

>d6nyaf_ d.20.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kstasslllrqyreltdpkkaipsfhieleddsniftwnigvmvlnedsiyhggffkaqm
rfpedfpfsppqfrftpaiyhpnvyrdgrlcisilhqsgdpetwspvqtvesvlisivsl
ledpninspanvdaavdyrknpeqykqrvkmeverskqdipkgfimp

SCOPe Domain Coordinates for d6nyaf_:

Click to download the PDB-style file with coordinates for d6nyaf_.
(The format of our PDB-style files is described here.)

Timeline for d6nyaf_:

  • d6nyaf_ is new in SCOPe 2.07-stable