Lineage for d6oelb2 (6oel B:97-199)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2371691Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2371692Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2372165Protein automated matches [190888] (2 species)
    not a true protein
  7. 2372168Species Human (Homo sapiens) [TaxId:9606] [188282] (32 PDB entries)
  8. 2372237Domain d6oelb2: 6oel B:97-199 [372660]
    Other proteins in same PDB: d6oela_, d6oelb3, d6oelc1, d6oell1, d6oell2
    automated match to d3bpnb2
    complexed with fuc, nag, no3

Details for d6oelb2

PDB Entry: 6oel (more details), 3.1 Å

PDB Description: engineered fab bound to il-4 receptor
PDB Compounds: (B:) Interleukin-4 receptor subunit alpha

SCOPe Domain Sequences for d6oelb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6oelb2 b.1.2.1 (B:97-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kprapgnltvhtnvsdtllltwsnpyppdnylynhltyavniwsendpadfriynvtyle
pslriaastlksgisyrarvrawaqcynttwsewspstkwhns

SCOPe Domain Coordinates for d6oelb2:

Click to download the PDB-style file with coordinates for d6oelb2.
(The format of our PDB-style files is described here.)

Timeline for d6oelb2: