Lineage for d1rtae_ (1rta E:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) Fold d.5: RNase A-like [54075] (1 superfamily) Superfamily d.5.1: RNase A-like [54076] (1 family) 
Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins) Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species) Species Cow (Bos taurus) [TaxId:9913] [54079] (93 PDB entries) 
Domain d1rtae_: 1rta E: [37266]
Details for d1rtae_
PDB Entry: 1rta (more details), 2.5 Å
PDB Description: crystal structure disposition of thymidylic acid tetramer in complex with ribonuclease a
SCOP Domain Sequences for d1rtae_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rtae_ d.5.1.1 (E:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv
SCOP Domain Coordinates for d1rtae_:
Click to download the PDB-style file with coordinates for d1rtae_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rtae_:
- d1rtae_ appears in SCOP 1.57
- d1rtae_ appears in the current release, SCOPe 2.08
View in 3D