Lineage for d6oela_ (6oel A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2318696Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2318697Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2318797Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2318918Protein Interleukin-4 (IL-4) [47291] (1 species)
  7. 2318919Species Human (Homo sapiens) [TaxId:9606] [47292] (18 PDB entries)
  8. 2318930Domain d6oela_: 6oel A: [372650]
    Other proteins in same PDB: d6oelb1, d6oelb2, d6oelb3, d6oelc1, d6oell1, d6oell2
    automated match to d2b8ua_
    complexed with fuc, nag, no3

Details for d6oela_

PDB Entry: 6oel (more details), 3.1 Å

PDB Description: engineered fab bound to il-4 receptor
PDB Compounds: (A:) engineered Interleukin-4, RGA variant

SCOPe Domain Sequences for d6oela_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6oela_ a.26.1.2 (A:) Interleukin-4 (IL-4) {Human (Homo sapiens) [TaxId: 9606]}
cditlqeiiktlnslteqktlcteltvtdifaaskntteketfcraatvlrqfyshhekd
trclgataqqfhrhkqlirflkrldrnlwglaglnscpvkeanqstlenflerlrvimqs
kwfkcga

SCOPe Domain Coordinates for d6oela_:

Click to download the PDB-style file with coordinates for d6oela_.
(The format of our PDB-style files is described here.)

Timeline for d6oela_: