Lineage for d1cjq.1 (1cjq A:,B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 29802Fold d.5: RNase A-like [54075] (1 superfamily)
  4. 29803Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
  5. 29804Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 29839Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 29840Species Cow (Bos taurus) [TaxId:9913] [54079] (93 PDB entries)
  8. 29942Domain d1cjq.1: 1cjq A:,B: [37265]

Details for d1cjq.1

PDB Entry: 1cjq (more details), 3 Å

PDB Description: x-ray crystallographic studies of the denaturation of the denaturation of ribonuclease s.

SCOP Domain Sequences for d1cjq.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1cjq.1 d.5.1.1 (A:,B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsXnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackn
gqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfdasv

SCOP Domain Coordinates for d1cjq.1:

Click to download the PDB-style file with coordinates for d1cjq.1.
(The format of our PDB-style files is described here.)

Timeline for d1cjq.1: