Lineage for d6nyae1 (6nya E:1-76)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2932413Protein automated matches [190118] (16 species)
    not a true protein
  7. 2932682Species Wheat (Triticum aestivum) [TaxId:4565] [372585] (1 PDB entry)
  8. 2932684Domain d6nyae1: 6nya E:1-76 [372642]
    Other proteins in same PDB: d6nyab2, d6nyac_, d6nyae2, d6nyaf_
    automated match to d4k1rb_
    complexed with atp, edo, mg, so4

Details for d6nyae1

PDB Entry: 6nya (more details), 2.07 Å

PDB Description: crystal structure of ubiquitin e1 (uba1) in complex with ubc3 (cdc34) and ubiquitin
PDB Compounds: (E:) Ubiquitin

SCOPe Domain Sequences for d6nyae1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nyae1 d.15.1.1 (E:1-76) automated matches {Wheat (Triticum aestivum) [TaxId: 4565]}
mqifvrtltgrtitlevessdtidnvrariqdregippdqqrlifagrqledgrtladyn
iqrestlhlvlrlrgg

SCOPe Domain Coordinates for d6nyae1:

Click to download the PDB-style file with coordinates for d6nyae1.
(The format of our PDB-style files is described here.)

Timeline for d6nyae1: