Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein automated matches [190118] (16 species) not a true protein |
Species Wheat (Triticum aestivum) [TaxId:4565] [372585] (1 PDB entry) |
Domain d6nyae1: 6nya E:1-76 [372642] Other proteins in same PDB: d6nyab2, d6nyac_, d6nyae2, d6nyaf_ automated match to d4k1rb_ complexed with atp, edo, mg, so4 |
PDB Entry: 6nya (more details), 2.07 Å
SCOPe Domain Sequences for d6nyae1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nyae1 d.15.1.1 (E:1-76) automated matches {Wheat (Triticum aestivum) [TaxId: 4565]} mqifvrtltgrtitlevessdtidnvrariqdregippdqqrlifagrqledgrtladyn iqrestlhlvlrlrgg
Timeline for d6nyae1:
View in 3D Domains from other chains: (mouse over for more information) d6nyab1, d6nyab2, d6nyac_, d6nyaf_ |