Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) |
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
Protein Zn metallo-beta-lactamase [56283] (14 species) |
Species Serratia marcescens [TaxId:615] [190018] (8 PDB entries) |
Domain d6jeda_: 6jed A: [372636] automated match to d1jjta_ complexed with epe, mcr, zn |
PDB Entry: 6jed (more details), 1.57 Å
SCOPe Domain Sequences for d6jeda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jeda_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Serratia marcescens [TaxId: 615]} slpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtw fvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvn ywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakl lkskygkaklvvpshsevgdasllkltleqavkglneskkp
Timeline for d6jeda_: