Lineage for d6ihva1 (6ihv A:1-241)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007405Fold d.219: PP2C-like [81607] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; antiparallel beta sheets
  4. 3007406Superfamily d.219.1: PP2C-like [81606] (2 families) (S)
    contain binuclear metal (Mn) centre
  5. 3007425Family d.219.1.0: automated matches [191371] (1 protein)
    not a true family
  6. 3007426Protein automated matches [190449] (7 species)
    not a true protein
  7. 3007436Species Staphylococcus aureus [TaxId:1280] [321697] (7 PDB entries)
  8. 3007442Domain d6ihva1: 6ihv A:1-241 [372625]
    Other proteins in same PDB: d6ihva2
    automated match to d2j82a_
    complexed with mg; mutant

Details for d6ihva1

PDB Entry: 6ihv (more details), 1.9 Å

PDB Description: crystal structure of bacterial serine phosphatase bearing r161e mutation
PDB Compounds: (A:) Phosphorylated protein phosphatase

SCOPe Domain Sequences for d6ihva1:

Sequence, based on SEQRES records: (download)

>d6ihva1 d.219.1.0 (A:1-241) automated matches {Staphylococcus aureus [TaxId: 1280]}
eaqfftdtgqhrdknedaggifynqtnqqllvlcdgmgghkagevaskfvtdelksrfea
enlieqhqaenwlrnnikdinfqlyhyaqenaeykgmgttcvcalvfeksvvianvgdsr
ayvinsrqieqitsdhsfvnhlvltgqitpeeafthpqeniitkvmgtdkrvspdlfikr
lnfydylllnsdgltdyvkdneikrllvkegtiedhgdqlmqlaldnhskdnvtfilaai
e

Sequence, based on observed residues (ATOM records): (download)

>d6ihva1 d.219.1.0 (A:1-241) automated matches {Staphylococcus aureus [TaxId: 1280]}
eaqfftdtgqhrdknedaggifynqtnqqllvlcdgmgghkagevaskfvtdelksrfea
enlieqhqaenwlrnnikdinfqlyhyaqenaeykgmgttcvcalvfeksvvianvgdsr
ayvinsrqieqitsdhsitkvmgtdkrvspdlfikrlnfydylllnsdgltdyvkdneik
rllvkegtiedhgdqlmqlaldnhskdnvtfilaaie

SCOPe Domain Coordinates for d6ihva1:

Click to download the PDB-style file with coordinates for d6ihva1.
(The format of our PDB-style files is described here.)

Timeline for d6ihva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ihva2