![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.0: automated matches [191322] (1 protein) not a true family |
![]() | Protein automated matches [190120] (9 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186843] (28 PDB entries) |
![]() | Domain d6nyac_: 6nya C: [372602] Other proteins in same PDB: d6nyab1, d6nyab2, d6nyae1, d6nyae2 automated match to d3fn1b_ complexed with atp, edo, mg, so4 |
PDB Entry: 6nya (more details), 2.07 Å
SCOPe Domain Sequences for d6nyac_:
Sequence, based on SEQRES records: (download)
>d6nyac_ d.20.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} srkstasslllrqyreltdpkkaipsfhieleddsniftwnigvmvlnedsiyhggffka qmrfpedfpfsppqfrftpaiyhpnvyrdgrlcisilhqsgdpmtdepdaetwspvqtve svlisivslledpninspanvdaavdyrknpeqykqrvkmeverskqdipkgfimptse
>d6nyac_ d.20.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} srkstasslllrqyreltdpkkaipsfhieleddsniftwnigvmvlnedsiyhggffka qmrfpedfpfsppqfrftpaiyhpnvyrdgrlcisilhqsaetwspvqtvesvlisivsl ledpninspanvdaavdyrknpeqykqrvkmeverskqdipkgfimptse
Timeline for d6nyac_: