Lineage for d6nyac_ (6nya C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2939466Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 2939467Protein automated matches [190120] (9 species)
    not a true protein
  7. 2939474Species Human (Homo sapiens) [TaxId:9606] [186843] (28 PDB entries)
  8. 2939496Domain d6nyac_: 6nya C: [372602]
    Other proteins in same PDB: d6nyab1, d6nyab2, d6nyae1, d6nyae2
    automated match to d3fn1b_
    complexed with atp, edo, mg, so4

Details for d6nyac_

PDB Entry: 6nya (more details), 2.07 Å

PDB Description: crystal structure of ubiquitin e1 (uba1) in complex with ubc3 (cdc34) and ubiquitin
PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2-34 kDa

SCOPe Domain Sequences for d6nyac_:

Sequence, based on SEQRES records: (download)

>d6nyac_ d.20.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srkstasslllrqyreltdpkkaipsfhieleddsniftwnigvmvlnedsiyhggffka
qmrfpedfpfsppqfrftpaiyhpnvyrdgrlcisilhqsgdpmtdepdaetwspvqtve
svlisivslledpninspanvdaavdyrknpeqykqrvkmeverskqdipkgfimptse

Sequence, based on observed residues (ATOM records): (download)

>d6nyac_ d.20.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srkstasslllrqyreltdpkkaipsfhieleddsniftwnigvmvlnedsiyhggffka
qmrfpedfpfsppqfrftpaiyhpnvyrdgrlcisilhqsaetwspvqtvesvlisivsl
ledpninspanvdaavdyrknpeqykqrvkmeverskqdipkgfimptse

SCOPe Domain Coordinates for d6nyac_:

Click to download the PDB-style file with coordinates for d6nyac_.
(The format of our PDB-style files is described here.)

Timeline for d6nyac_: