SCOPe 2.06: Domain d1cjr.1: 1cjr A:,B:

Lineage for d1cjr.1 (1cjr A:,B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (188 PDB entries)

8. Domain d1cjr.1: 1cjr A:,B: [37260]
   synthetic S peptide
   complexed with so4

Details for d1cjr.1

PDB Entry: 1cjr, 2.3 Å

PDB Description: x-ray crystallographic studies of denaturation in ribonuclease s

PDB Compounds: (A:) protein (ribonuclease s), (B:) protein (ribonuclease s)

SCOPe Domain Sequences for d1cjr.1:

Sequence; same for both SEQRES and ATOM records:

>g1cjr.1 d.5.1.1 (A:,B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsXnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackn
gqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfdasv

Timeline for d1cjr.1:

• d1cjr.1 first appeared (with stable ids) in SCOP 1.55
  
• d1cjr.1 appears in SCOPe 2.05
  
• d1cjr.1 appears in SCOPe 2.07
  
• d1cjr.1 appears in the current release, SCOPe 2.08