SCOP 1.63: Domain d1cjr.1: 1cjr A:,B:

Lineage for d1cjr.1 (1cjr A:,B:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (1 family)
   can be classified as disulphide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (115 PDB entries)

8. Domain d1cjr.1: 1cjr A:,B: [37260]
   synthetic S peptide
   complexed with so4

Details for d1cjr.1

PDB Entry: 1cjr, 2.3 Å

PDB Description: x-ray crystallographic studies of denaturation in ribonuclease s

SCOP Domain Sequences for d1cjr.1:

Sequence; same for both SEQRES and ATOM records:

>g1cjr.1 d.5.1.1 (A:,B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsXnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackn
gqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfdasv

Timeline for d1cjr.1:

• d1cjr.1 first appeared (with stable ids) in SCOP 1.55
  
• d1cjr.1 appears in SCOP 1.61
  
• d1cjr.1 appears in SCOP 1.65
  
• d1cjr.1 appears in the current release, SCOPe 2.08