Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (1 family) can be classified as disulphide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins) |
Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [54079] (115 PDB entries) |
Domain d1cjr.1: 1cjr A:,B: [37260] synthetic S peptide complexed with so4 |
PDB Entry: 1cjr (more details), 2.3 Å
SCOP Domain Sequences for d1cjr.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1cjr.1 d.5.1.1 (A:,B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)} ketaaakferqhmdsXnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackn gqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfdasv
Timeline for d1cjr.1: