Lineage for d6nyoe1 (6nyo E:1-76)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2501112Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2502019Protein automated matches [190118] (17 species)
    not a true protein
  7. 3072526Species Schizosaccharomyces pombe [TaxId:4896] [372588] (1 PDB entry)
  8. 3072527Domain d6nyoe1: 6nyo E:1-76 [372589]
    Other proteins in same PDB: d6nyoa_, d6nyoe2
    automated match to d3cmmb_
    complexed with edo, po4, u94

Details for d6nyoe1

PDB Entry: 6nyo (more details), 1.5 Å

PDB Description: crystal structure of a human cdc34-ubiquitin thioester mimetic
PDB Compounds: (E:) Ubiquitin

SCOPe Domain Sequences for d6nyoe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nyoe1 d.15.1.1 (E:1-76) automated matches {Schizosaccharomyces pombe [TaxId: 4896]}
mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrgg

SCOPe Domain Coordinates for d6nyoe1:

Click to download the PDB-style file with coordinates for d6nyoe1.
(The format of our PDB-style files is described here.)

Timeline for d6nyoe1:

  • d6nyoe1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6nyoe2
View in 3D
Domains from other chains:
(mouse over for more information)
d6nyoa_