Lineage for d6nyoe1 (6nyo E:1-76)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. Protein automated matches [190118] (16 species)
    not a true protein
  7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [372588] (1 PDB entry)
  8. Domain d6nyoe1: 6nyo E:1-76 [372589]
    Other proteins in same PDB: d6nyoa_, d6nyoe2
    automated match to d3cmmb_
    complexed with edo, po4, u94

Details for d6nyoe1

PDB Entry: 6nyo (more details), 1.5 Å

PDB Description: crystal structure of a human cdc34-ubiquitin thioester mimetic
PDB Compounds: (E:) Ubiquitin

SCOPe Domain Sequences for d6nyoe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nyoe1 d.15.1.1 (E:1-76) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrgg

SCOPe Domain Coordinates for d6nyoe1 are not available.

Timeline for d6nyoe1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6nyoe2
View in 3D
Domains from other chains:
(mouse over for more information)
d6nyoa_