Lineage for d1d5e.1 (1d5e A:,B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 29802Fold d.5: RNase A-like [54075] (1 superfamily)
  4. 29803Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
  5. 29804Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 29839Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 29840Species Cow (Bos taurus) [TaxId:9913] [54079] (93 PDB entries)
  8. 29934Domain d1d5e.1: 1d5e A:,B: [37257]

Details for d1d5e.1

PDB Entry: 1d5e (more details), 2.25 Å

PDB Description: the role of phenylalanine 8 in the stabilization of the s protein-s peptide interaction: packing and cavities

SCOP Domain Sequences for d1d5e.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1d5e.1 d.5.1.1 (A:,B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaaklerqhldsXnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackn
gqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfdasv

SCOP Domain Coordinates for d1d5e.1:

Click to download the PDB-style file with coordinates for d1d5e.1.
(The format of our PDB-style files is described here.)

Timeline for d1d5e.1: