![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Streptoalloteichus hindustanus [TaxId:2017] [372525] (4 PDB entries) |
![]() | Domain d6j88b_: 6j88 B: [372560] automated match to d4z5qa_ complexed with b9o, hem |
PDB Entry: 6j88 (more details), 2.35 Å
SCOPe Domain Sequences for d6j88b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j88b_ a.104.1.0 (B:) automated matches {Streptoalloteichus hindustanus [TaxId: 2017]} tpapvrypfgeavrldlhptyaelrerrtllrvrvphgddawlvtrhedvrtvltdprfs raaaagrdearltplvirtsvmgvdppdhtrlrrlvatafsrrgvehlrpgitalvrrlt ddmvgqgppvdlvrsfvtplsglvicdllgvpyadrsrfrhwleaffsitalpadevavr ieamygyiaelvalrraeptedllgglvrardrdgscseeelvdlanvlllagyhttasq lasslfvlltqpehaellrsrpelapraveellryvpliahvtfaryatedvwlggtlvr ageavlpavpsanrdaevfdepdrldltrrhnphlafghglhhclgaslvrvqmevaltm llgrfpdlalaappdevpwtrgmqarsplrlpvtw
Timeline for d6j88b_: