SCOPe 2.07: Domain d6ea3a_: 6ea3 A:

Lineage for d6ea3a_ (6ea3 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
   beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.100.2: MbtH-like [160582] (2 families)
   the first helix is replaced with an extended loop; contains extra C-terminal helix of variable position

5. Family d.100.2.0: automated matches [254253] (1 protein)
   not a true family

6. Protein automated matches [254578] (8 species)
   not a true protein

7. Species Thermobifida fusca [TaxId:269800] [372555] (2 PDB entries)

8. Domain d6ea3a_: 6ea3 A: [372556]
   automated match to d2gpfa1
   complexed with srp

Details for d6ea3a_

PDB Entry: 6ea3, 1.65 Å

PDB Description: thermobifida fusca fsch adenylation domain complexed with mbth-like protein fsck and ser-amp

PDB Compounds: (A:) MbtH-like protein

SCOPe Domain Sequences for d6ea3a_:

Sequence; same for both SEQRES and ATOM records:

>d6ea3a_ d.100.2.0 (A:) automated matches {Thermobifida fusca [TaxId: 269800]}
tnpfdddegvflvlvndedqyslwpefaevpqgwrtvfgptsraaaldyinthwtdlrpr
slreameahs

Timeline for d6ea3a_:

• d6ea3a_ is new in SCOPe 2.07-stable
  
• d6ea3a_ appears in the current release, SCOPe 2.08