Lineage for d6ea3a_ (6ea3 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967247Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 2967311Superfamily d.100.2: MbtH-like [160582] (2 families) (S)
    the first helix is replaced with an extended loop; contains extra C-terminal helix of variable position
  5. 2967321Family d.100.2.0: automated matches [254253] (1 protein)
    not a true family
  6. 2967322Protein automated matches [254578] (8 species)
    not a true protein
  7. 2967337Species Thermobifida fusca [TaxId:269800] [372555] (2 PDB entries)
  8. 2967338Domain d6ea3a_: 6ea3 A: [372556]
    automated match to d2gpfa1
    complexed with srp

Details for d6ea3a_

PDB Entry: 6ea3 (more details), 1.65 Å

PDB Description: thermobifida fusca fsch adenylation domain complexed with mbth-like protein fsck and ser-amp
PDB Compounds: (A:) MbtH-like protein

SCOPe Domain Sequences for d6ea3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ea3a_ d.100.2.0 (A:) automated matches {Thermobifida fusca [TaxId: 269800]}
tnpfdddegvflvlvndedqyslwpefaevpqgwrtvfgptsraaaldyinthwtdlrpr
slreameahs

SCOPe Domain Coordinates for d6ea3a_:

Click to download the PDB-style file with coordinates for d6ea3a_.
(The format of our PDB-style files is described here.)

Timeline for d6ea3a_: