SCOPe 2.08: Domain d1d5d.1: 1d5d A:,B:

Lineage for d1d5d.1 (1d5d A:,B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (212 PDB entries)

8. Domain d1d5d.1: 1d5d A:,B: [37255]
   complexed with so4

Details for d1d5d.1

PDB Entry: 1d5d, 2.25 Å

PDB Description: the role of phenylalanine 8 in the stabilization of the s protein-s peptide interaction: packing and cavities

PDB Compounds: (A:) s peptide, (B:) RNAse s

SCOPe Domain Sequences for d1d5d.1:

Sequence; same for both SEQRES and ATOM records:

>g1d5d.1 d.5.1.1 (A:,B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakmerqhldsXnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackn
gqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfdasv

Timeline for d1d5d.1:

• d1d5d.1 first appeared (with stable ids) in SCOP 1.55
  
• d1d5d.1 appears in SCOPe 2.07