Lineage for d6ebvd_ (6ebv D:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. Family c.55.1.14: Fumble-like [159623] (6 proteins)
    Pfam PF03630; type II pantothenate kinase-like
  6. Protein automated matches [259360] (2 species)
    not a true protein
  7. Species Staphylococcus aureus [TaxId:1280] [357241] (6 PDB entries)
  8. Domain d6ebvd_: 6ebv D: [372548]
    automated match to d4nb4a_
    complexed with 27q, adp

Details for d6ebvd_

PDB Entry: 6ebv (more details), 3 Å

PDB Description: staphylococcus aureus type ii pantothenate kinase in complex with adp and pantothenate analog deoxy-n7-pan
PDB Compounds: (D:) Type II pantothenate kinase

SCOPe Domain Sequences for d6ebvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ebvd_ c.55.1.14 (D:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen
inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg
ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl
hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy
tvlrgckpyyvengafsgaigalyl

SCOPe Domain Coordinates for d6ebvd_ are not available.

Timeline for d6ebvd_:

Domains from other chains:
(mouse over for more information)
d6ebva_, d6ebvb_, d6ebvc_