Lineage for d6jx2c1 (6jx2 C:2-184)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846658Species Corynebacterium glutamicum [TaxId:196627] [315006] (3 PDB entries)
  8. 2846675Domain d6jx2c1: 6jx2 C:2-184 [372523]
    Other proteins in same PDB: d6jx2a2, d6jx2b2, d6jx2c2, d6jx2d2
    automated match to d4xiya1
    complexed with edo, mg, nap

Details for d6jx2c1

PDB Entry: 6jx2 (more details), 2.6 Å

PDB Description: crystal structure of ketol-acid reductoisomerase from corynebacterium glutamicum
PDB Compounds: (C:) Ketol-acid reductoisomerase (NADP(+))

SCOPe Domain Sequences for d6jx2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jx2c1 c.2.1.0 (C:2-184) automated matches {Corynebacterium glutamicum [TaxId: 196627]}
aiellydadadlsliqgrkvaivgygsqghahsqnlrdsgvevviglregsksaekakea
gfevkttaeaaawadvimllapdtsqaeiftndiepnlnagdallfghglnihfdlikpa
ddiivgmvapkgpghlvrrqfvdgkgvpcliavdqdptgtaqaltlsyaaaiggaragvi
ptt

SCOPe Domain Coordinates for d6jx2c1:

Click to download the PDB-style file with coordinates for d6jx2c1.
(The format of our PDB-style files is described here.)

Timeline for d6jx2c1: