SCOP 1.59: Domain d3srn.1: 3srn A:,B:

Lineage for d3srn.1 (3srn A:,B:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)

4. Superfamily d.5.1: RNase A-like [54076] (1 family)

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (110 PDB entries)

8. Domain d3srn.1: 3srn A:,B: [37252]

Details for d3srn.1

PDB Entry: 3srn, 2 Å

PDB Description: structural changes that accompany the reduced catalytic efficiency of two semisynthetic ribonuclease analogs

SCOP Domain Sequences for d3srn.1:

Sequence; same for both SEQRES and ATOM records:

>g3srn.1 d.5.1.1 (A:,B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnXpyvpvh
fnasv

Timeline for d3srn.1:

• d3srn.1 first appeared (with stable ids) in SCOP 1.55
  
• d3srn.1 appears in SCOP 1.57
  
• d3srn.1 appears in SCOP 1.61
  
• d3srn.1 appears in the current release, SCOPe 2.08