Lineage for d6h4la_ (6h4l A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753922Protein Titin [49172] (1 species)
  7. 2753923Species Human (Homo sapiens), different modules [TaxId:9606] [49173] (8 PDB entries)
  8. 2753927Domain d6h4la_: 6h4l A: [372509]
    automated match to d3qp3c_
    complexed with cl, zn

Details for d6h4la_

PDB Entry: 6h4l (more details), 1.6 Å

PDB Description: structure of titin m4 trigonal form
PDB Compounds: (A:) titin

SCOPe Domain Sequences for d6h4la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h4la_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]}
tldhapritlrmrshrvpcgqntrfilnvqskptaevkwyhngvelqesskihytntsgv
ltleildchtddsgtyravctnykgeasdyatldvt

SCOPe Domain Coordinates for d6h4la_:

Click to download the PDB-style file with coordinates for d6h4la_.
(The format of our PDB-style files is described here.)

Timeline for d6h4la_: