Lineage for d6hgwa_ (6hgw A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2475178Family c.69.1.11: Epoxide hydrolase [53525] (3 proteins)
  6. 2475247Protein automated matches [271870] (2 species)
    not a true protein
  7. 2475248Species Human (Homo sapiens) [TaxId:9606] [271874] (64 PDB entries)
  8. 3072446Domain d6hgwa_: 6hgw A: [372508]
    automated match to d4c4za_
    complexed with g3w

Details for d6hgwa_

PDB Entry: 6hgw (more details), 2.41 Å

PDB Description: soluble epoxide hydrolase in complex with 2-(4-fluorophenyl)-n-(4- phenoxybenzyl)ethanamine
PDB Compounds: (A:) Bifunctional epoxide hydrolase 2

SCOPe Domain Sequences for d6hgwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hgwa_ c.69.1.11 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptscnpsdmshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrv
lamdmkgygessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfy
pervravaslntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfksl
frasdesvlsmhkvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrn
mernwkwackslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqm
dkptevnqilikwldsdar

SCOPe Domain Coordinates for d6hgwa_:

Click to download the PDB-style file with coordinates for d6hgwa_.
(The format of our PDB-style files is described here.)

Timeline for d6hgwa_:

  • d6hgwa_ is new in SCOPe 2.07-stable