Lineage for d6ebvc_ (6ebv C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492576Family c.55.1.14: Fumble-like [159623] (4 proteins)
    Pfam PF03630; type II pantothenate kinase-like
  6. 2492619Protein automated matches [259360] (2 species)
    not a true protein
  7. 2492620Species Staphylococcus aureus [TaxId:1280] [357241] (6 PDB entries)
  8. 2492643Domain d6ebvc_: 6ebv C: [372501]
    automated match to d4nb4a_
    complexed with 27q, adp

Details for d6ebvc_

PDB Entry: 6ebv (more details), 3 Å

PDB Description: staphylococcus aureus type ii pantothenate kinase in complex with adp and pantothenate analog deoxy-n7-pan
PDB Compounds: (C:) Type II pantothenate kinase

SCOPe Domain Sequences for d6ebvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ebvc_ c.55.1.14 (C:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen
inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg
ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl
hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy
tvlrgckpyyvengafsgaigalylek

SCOPe Domain Coordinates for d6ebvc_:

Click to download the PDB-style file with coordinates for d6ebvc_.
(The format of our PDB-style files is described here.)

Timeline for d6ebvc_: