Lineage for d6e5rb_ (6e5r B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2395396Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2395397Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2395948Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2396280Protein automated matches [190295] (7 species)
    not a true protein
  7. 2396296Species Human (Homo sapiens) [TaxId:9606] [187133] (101 PDB entries)
  8. 3072433Domain d6e5rb_: 6e5r B: [372495]
    automated match to d5u6gg_
    complexed with act, gol; mutant

Details for d6e5rb_

PDB Entry: 6e5r (more details), 2.59 Å

PDB Description: crystal structure of the apo domain-swapped dimer q108k:t51d:a28c mutant of human cellular retinol binding protein ii
PDB Compounds: (B:) Retinol-binding protein 2

SCOPe Domain Sequences for d6e5rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e5rb_ b.60.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trdqngtwemesnenfegymkaldidfctrkiavrltqtkvidqdgdnfkdkttstfrny
dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt
cgdqvcrqvfkkk

SCOPe Domain Coordinates for d6e5rb_:

Click to download the PDB-style file with coordinates for d6e5rb_.
(The format of our PDB-style files is described here.)

Timeline for d6e5rb_:

  • d6e5rb_ is new in SCOPe 2.07-stable