Lineage for d6p3hc1 (6p3h C:7-174)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546594Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2546595Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2546724Family d.21.1.0: automated matches [191386] (1 protein)
    not a true family
  6. 2546725Protein automated matches [190491] (18 species)
    not a true protein
  7. 2546767Species Novosphingobium sp. [TaxId:164608] [372398] (3 PDB entries)
  8. 2546772Domain d6p3hc1: 6p3h C:7-174 [372483]
    Other proteins in same PDB: d6p3ha3, d6p3hb3, d6p3hc3, d6p3hd3
    automated match to d3g7ka1
    complexed with cl, nqm

Details for d6p3hc1

PDB Entry: 6p3h (more details), 1.62 Å

PDB Description: crystal structure of ligu(k66m) bound to substrate
PDB Compounds: (C:) (4E)-oxalomesaconate Delta-isomerase

SCOPe Domain Sequences for d6p3hc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6p3hc1 d.21.1.0 (C:7-174) automated matches {Novosphingobium sp. [TaxId: 164608]}
nmdsapcmwmrggtskggyflradlpadtaardafllavmgspdprqidgmggadpltsm
vavvskserpgidvdylflqvfvdqaivtdaqncgnilagvgpfaierglvaasgdetrv
aifmentgqvavatvrtpggsvtyagdaaidgvpgthapiptefrdta

SCOPe Domain Coordinates for d6p3hc1:

Click to download the PDB-style file with coordinates for d6p3hc1.
(The format of our PDB-style files is described here.)

Timeline for d6p3hc1: