| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (9 proteins) |
| Protein Cyclin A [47956] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries) Uniprot P20248 175-432 |
| Domain d6p3wb1: 6p3w B:176-309 [372478] Other proteins in same PDB: d6p3wa_, d6p3wc_ automated match to d1finb1 complexed with po4 |
PDB Entry: 6p3w (more details), 2.54 Å
SCOPe Domain Sequences for d6p3wb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6p3wb1 a.74.1.1 (B:176-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
hlvlkvltfdlaap
Timeline for d6p3wb1:
View in 3DDomains from other chains: (mouse over for more information) d6p3wa_, d6p3wc_, d6p3wd1, d6p3wd2 |