SCOPe 2.08: Domain d6p3wb1: 6p3w B:176-309

Lineage for d6p3wb1 (6p3w B:176-309)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
   Uniprot P20248 175-432

8. Domain d6p3wb1: 6p3w B:176-309 [372478]
   Other proteins in same PDB: d6p3wa_, d6p3wc_
   automated match to d1finb1
   complexed with po4

Details for d6p3wb1

PDB Entry: 6p3w, 2.54 Å

PDB Description: crystal structure of the cyclin a-cdk2-orc1 complex

PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d6p3wb1:

Sequence; same for both SEQRES and ATOM records:

>d6p3wb1 a.74.1.1 (B:176-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
hlvlkvltfdlaap

Timeline for d6p3wb1:

• d6p3wb1 first appeared in SCOPe 2.07