SCOPe 2.07: Domain d6p3jb1: 6p3j B:2-174

Lineage for d6p3jb1 (6p3j B:2-174)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.0: automated matches [191386] (1 protein)
   not a true family

6. Protein automated matches [190491] (18 species)
   not a true protein

7. Species Novosphingobium sp. [TaxId:164608] [372398] (3 PDB entries)

8. Domain d6p3jb1: 6p3j B:2-174 [372462]
   Other proteins in same PDB: d6p3ja3, d6p3jb3
   automated match to d3g7ka1
   complexed with ca, cl, na

Details for d6p3jb1

PDB Entry: 6p3j, 2.02 Å

PDB Description: crystal structure of ligu

PDB Compounds: (B:) (4E)-oxalomesaconate Delta-isomerase

SCOPe Domain Sequences for d6p3jb1:

Sequence; same for both SEQRES and ATOM records:

>d6p3jb1 d.21.1.0 (B:2-174) automated matches {Novosphingobium sp. [TaxId: 164608]}
prrdrnmdsapcmwmrggtskggyflradlpadtaardafllavmgspdprqidgmggad
pltskvavvskserpgidvdylflqvfvdqaivtdaqncgnilagvgpfaierglvaasg
detrvaifmentgqvavatvrtpggsvtyagdaaidgvpgthapiptefrdta

Timeline for d6p3jb1:

• d6p3jb1 is new in SCOPe 2.07-stable
  
• d6p3jb1 appears in the current release, SCOPe 2.08