SCOPe 2.07: Domain d6s2aa1: 6s2a A:2-296

Lineage for d6s2aa1 (6s2a A:2-296)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families)

5. Family c.1.18.2: Bacterial PLC [51699] (2 proteins)

6. Protein automated matches [190760] (2 species)
   not a true protein

7. Species Bacillus cereus [TaxId:1396] [372449] (1 PDB entry)

8. Domain d6s2aa1: 6s2a A:2-296 [372453]
   Other proteins in same PDB: d6s2aa2, d6s2ab2, d6s2ac2
   automated match to d1gyma_
   complexed with ins; mutant

Details for d6s2aa1

PDB Entry: 6s2a, 2.7 Å

PDB Description: pi plc mutant h82a

PDB Compounds: (A:) 1-phosphatidylinositol phosphodiesterase

SCOPe Domain Sequences for d6s2aa1:

Sequence; same for both SEQRES and ATOM records:

>d6s2aa1 c.1.18.2 (A:2-296) automated matches {Bacillus cereus [TaxId: 1396]}
ssvnelenwskwmqpipdsiplarisipgthdsgtfklqnpikqvwgmtqeydfryqmdh
garifdirgrltddntivlhagplylyvtlhefineakqflkdnpsetiimslkkeyedm
kgaedsfsstfekkyfvdpiflktegniklgdargkivllkrysgsnepggynnfywpdn
etftttvnqnanvtvqdkykvsydekvksikdtmdetmnnsedlnhlyinftslssggta
wnspyyyasyinpeianyikqknparvgwviqdyinekwspllyqeviranksli

Timeline for d6s2aa1:

• d6s2aa1 is new in SCOPe 2.07-stable
  
• d6s2aa1 appears in the current release, SCOPe 2.08