Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) |
Family c.1.18.2: Bacterial PLC [51699] (2 proteins) |
Protein automated matches [190760] (2 species) not a true protein |
Species Bacillus cereus [TaxId:1396] [372449] (1 PDB entry) |
Domain d6s2ab1: 6s2a B:2-296 [372450] Other proteins in same PDB: d6s2aa2, d6s2ab2, d6s2ac2 automated match to d1gyma_ complexed with ins; mutant |
PDB Entry: 6s2a (more details), 2.7 Å
SCOPe Domain Sequences for d6s2ab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6s2ab1 c.1.18.2 (B:2-296) automated matches {Bacillus cereus [TaxId: 1396]} ssvnelenwskwmqpipdsiplarisipgthdsgtfklqnpikqvwgmtqeydfryqmdh garifdirgrltddntivlhagplylyvtlhefineakqflkdnpsetiimslkkeyedm kgaedsfsstfekkyfvdpiflktegniklgdargkivllkrysgsnepggynnfywpdn etftttvnqnanvtvqdkykvsydekvksikdtmdetmnnsedlnhlyinftslssggta wnspyyyasyinpeianyikqknparvgwviqdyinekwspllyqeviranksli
Timeline for d6s2ab1:
View in 3D Domains from other chains: (mouse over for more information) d6s2aa1, d6s2aa2, d6s2ac1, d6s2ac2 |