Lineage for d6s2ab1 (6s2a B:2-296)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839880Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 2839909Family c.1.18.2: Bacterial PLC [51699] (2 proteins)
  6. 2839924Protein automated matches [190760] (2 species)
    not a true protein
  7. 2839925Species Bacillus cereus [TaxId:1396] [372449] (1 PDB entry)
  8. 2839927Domain d6s2ab1: 6s2a B:2-296 [372450]
    Other proteins in same PDB: d6s2aa2, d6s2ab2, d6s2ac2
    automated match to d1gyma_
    complexed with ins; mutant

Details for d6s2ab1

PDB Entry: 6s2a (more details), 2.7 Å

PDB Description: pi plc mutant h82a
PDB Compounds: (B:) 1-phosphatidylinositol phosphodiesterase

SCOPe Domain Sequences for d6s2ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6s2ab1 c.1.18.2 (B:2-296) automated matches {Bacillus cereus [TaxId: 1396]}
ssvnelenwskwmqpipdsiplarisipgthdsgtfklqnpikqvwgmtqeydfryqmdh
garifdirgrltddntivlhagplylyvtlhefineakqflkdnpsetiimslkkeyedm
kgaedsfsstfekkyfvdpiflktegniklgdargkivllkrysgsnepggynnfywpdn
etftttvnqnanvtvqdkykvsydekvksikdtmdetmnnsedlnhlyinftslssggta
wnspyyyasyinpeianyikqknparvgwviqdyinekwspllyqeviranksli

SCOPe Domain Coordinates for d6s2ab1:

Click to download the PDB-style file with coordinates for d6s2ab1.
(The format of our PDB-style files is described here.)

Timeline for d6s2ab1: