SCOP 1.63: Domain d1afub_: 1afu B:

Lineage for d1afub_ (1afu B:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (1 family)
   can be classified as disulphide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (115 PDB entries)

8. Domain d1afub_: 1afu B: [37245]

Details for d1afub_

PDB Entry: 1afu, 2 Å

PDB Description: structure of ribonuclease a at 2.0 angstroms from monoclinic crystals

SCOP Domain Sequences for d1afub_:

Sequence; same for both SEQRES and ATOM records:

>d1afub_ d.5.1.1 (B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d1afub_:

• d1afub_ first appeared (with stable ids) in SCOP 1.55
  
• d1afub_ appears in SCOP 1.61
  
• d1afub_ appears in SCOP 1.65
  
• d1afub_ appears in the current release, SCOPe 2.08