Lineage for d6opka_ (6opk A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (20 species)
    not a true protein
  7. 2546164Species Norway rat (Rattus norvegicus) [TaxId:10116] [319413] (2 PDB entries)
  8. 3072379Domain d6opka_: 6opk A: [372441]
    automated match to d3sa0a_
    complexed with 390

Details for d6opka_

PDB Entry: 6opk (more details), 2.54 Å

PDB Description: phosphorylated erk2 with vertex-11e
PDB Compounds: (A:) Mitogen-activated protein kinase 1

SCOPe Domain Sequences for d6opka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6opka_ d.144.1.7 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqrtlr
eikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyfl
yqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvat
rwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqe
dlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalah
pyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqp

SCOPe Domain Coordinates for d6opka_:

Click to download the PDB-style file with coordinates for d6opka_.
(The format of our PDB-style files is described here.)

Timeline for d6opka_:

  • d6opka_ is new in SCOPe 2.07-stable