Lineage for d6quva_ (6quv A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2476142Protein automated matches [190047] (34 species)
    not a true protein
  7. 2476240Species Human (Homo sapiens) [TaxId:9606] [186768] (286 PDB entries)
  8. 2476331Domain d6quva_: 6quv A: [372431]
    automated match to d5us4a_
    complexed with gcp, jjn, mg

Details for d6quva_

PDB Entry: 6quv (more details), 1.48 Å

PDB Description: crystal structure of kras-g12d in complex with gmp-pcp and compound 15r
PDB Compounds: (A:) GTPase KRas

SCOPe Domain Sequences for d6quva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6quva_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk

SCOPe Domain Coordinates for d6quva_:

Click to download the PDB-style file with coordinates for d6quva_.
(The format of our PDB-style files is described here.)

Timeline for d6quva_: